Results for job id J00544
Job information:
Job id: J00544
Job name: abc
Job starting time: 2022-06-02/14:36:00
Job ending time: 2022-06-02/15:10:28
Peptide sequence: QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKV
Protein receptor structure: rec_clean.pdb
Top 10 predicted binding modes
Click the "View" button on the right panel to display the corresponding binding mode.
|
|
||||
| Models | Active | View | PepProScore | Download |
| Model 1 | -5.1 | Download | ||
| Model 2 | -4.96 | Download | ||
| Model 3 | -4.9 | Download | ||
| Model 4 | -4.9 | Download | ||
| Model 5 | -4.86 | Download | ||
| Model 6 | -4.75 | Download | ||
| Model 7 | -4.75 | Download | ||
| Model 8 | -4.68 | Download | ||
| Model 9 | -4.59 | Download | ||
| Model 10 | -4.59 | Download |
Download
Click Here to download all the results.
Note: Use ViewDock option in Chimera to display and analyze results on your local machine:
1) Open Chimera and click "Menu: File ... open" to open the receptor pdb file ("rec_clean.pdb");
2) Click "Menu: Tools ... Surface/Binding Analysis ... ViewDock" to open ViewDock and load the predicted peptide binding modes (e.g. "Top1k_models.pdb"). Once the file is successfully loaded, the program will ask for the file type. Choose "Dock 4, 5 or 6".