Results for job id J01039
Job information:
Job id: J01039
Job name: glp-RGRG
Job starting time: 2024-01-16/22:22:28
Job ending time: 2024-01-17/01:43:22
Peptide sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Protein receptor structure: rec_clean.pdb
Top 10 predicted binding modes
Click the "View" button on the right panel to display the corresponding binding mode.
|
||||
Models | Active | View | PepProScore | Download |
Model 1 | -6.78 | Download | ||
Model 2 | -6.6 | Download | ||
Model 3 | -6.52 | Download | ||
Model 4 | -6.26 | Download | ||
Model 5 | -6.16 | Download | ||
Model 6 | -6.13 | Download | ||
Model 7 | -6.02 | Download | ||
Model 8 | -5.98 | Download | ||
Model 9 | -5.95 | Download | ||
Model 10 | -5.95 | Download |
Download
Click Here to download all the results.
Note: Use ViewDock option in Chimera to display and analyze results on your local machine:
1) Open Chimera and click "Menu: File ... open" to open the receptor pdb file ("rec_clean.pdb");
2) Click "Menu: Tools ... Surface/Binding Analysis ... ViewDock" to open ViewDock and load the predicted peptide binding modes (e.g. "Top1k_models.pdb"). Once the file is successfully loaded, the program will ask for the file type. Choose "Dock 4, 5 or 6".