Art Figures

Results for job id J01054

Job information:
Job id: J01054
Job name: c8bis
Job starting time: 2024-02-02/05:53:35
Job ending time: 2024-02-02/06:09:41
Peptide sequence: MTSTVAIPQFFGNYPGVIPGSVPGGIPCPIPGTMPPANVPIPTSA
Protein receptor structure: rec_clean.pdb


Top 10 predicted binding modes
Click the "View" button on the right panel to display the corresponding binding mode.
Models Active View PepProScore Download
Model 1

-4.31 Download
Model 2

-4.07 Download
Model 3

-3.94 Download
Model 4

-3.86 Download
Model 5

-3.76 Download
Model 6

-3.68 Download
Model 7

-3.68 Download
Model 8

-3.64 Download
Model 9

-3.64 Download
Model 10

-3.57 Download

Download
Click Here to download all the results.


Note: Use ViewDock option in Chimera to display and analyze results on your local machine:
1) Open Chimera and click "Menu: File ... open" to open the receptor pdb file ("rec_clean.pdb");
2) Click "Menu: Tools ... Surface/Binding Analysis ... ViewDock" to open ViewDock and load the predicted peptide binding modes (e.g. "Top1k_models.pdb"). Once the file is successfully loaded, the program will ask for the file type. Choose "Dock 4, 5 or 6".

For questions or comments regarding this website, please Contact Us
Copyright 2021 - All Right Reserved