Results for job id J02525
Job information:
Job id: J02525
Job name: FN456A2
Job starting time: 2024-10-24/11:05:13
Job ending time: 2024-10-24/11:41:17
Peptide sequence: HPVGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQ
Protein receptor structure: rec_clean.pdb
Top 10 predicted binding modes
Click the "View" button on the right panel to display the corresponding binding mode.
|
|
||||
| Models | Active | View | PepProScore | Download |
| Model 1 | -6.19 | Download | ||
| Model 2 | -6.16 | Download | ||
| Model 3 | -5.69 | Download | ||
| Model 4 | -5.62 | Download | ||
| Model 5 | -5.59 | Download | ||
| Model 6 | -5.57 | Download | ||
| Model 7 | -5.56 | Download | ||
| Model 8 | -5.4 | Download | ||
| Model 9 | -5.38 | Download | ||
| Model 10 | -5.34 | Download |
Download
Click Here to download all the results.
Note: Use ViewDock option in Chimera to display and analyze results on your local machine:
1) Open Chimera and click "Menu: File ... open" to open the receptor pdb file ("rec_clean.pdb");
2) Click "Menu: Tools ... Surface/Binding Analysis ... ViewDock" to open ViewDock and load the predicted peptide binding modes (e.g. "Top1k_models.pdb"). Once the file is successfully loaded, the program will ask for the file type. Choose "Dock 4, 5 or 6".