Results for job id J02886
Job information:
Job id: J02886
Job name: CRF1EDUN3
Job starting time: 2025-02-05/18:25:50
Job ending time: 2025-02-06/07:15:48
Peptide sequence: SLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
Protein receptor structure: rec_clean.pdb
Top 10 predicted binding modes
Click the "View" button on the right panel to display the corresponding binding mode.
|
|
||||
| Models | Active | View | PepProScore | Download |
| Model 1 | -6.9 | Download | ||
| Model 2 | -6.04 | Download | ||
| Model 3 | -6.0 | Download | ||
| Model 4 | -5.98 | Download | ||
| Model 5 | -5.91 | Download | ||
| Model 6 | -5.91 | Download | ||
| Model 7 | -5.91 | Download | ||
| Model 8 | -5.88 | Download | ||
| Model 9 | -5.88 | Download | ||
| Model 10 | -5.76 | Download |
Download
Click Here to download all the results.
Note: Use ViewDock option in Chimera to display and analyze results on your local machine:
1) Open Chimera and click "Menu: File ... open" to open the receptor pdb file ("rec_clean.pdb");
2) Click "Menu: Tools ... Surface/Binding Analysis ... ViewDock" to open ViewDock and load the predicted peptide binding modes (e.g. "Top1k_models.pdb"). Once the file is successfully loaded, the program will ask for the file type. Choose "Dock 4, 5 or 6".