Art Figures

Results for job id J03117

Job information:
Job id: J03117
Job name: PTHR1_PTH134xiu
Job starting time: 2025-04-17/10:25:00
Job ending time: 2025-04-17/12:11:18
Peptide sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFGGRRRRRRRRR
Protein receptor structure: rec_clean.pdb


Top 10 predicted binding modes
Click the "View" button on the right panel to display the corresponding binding mode.
Models Active View PepProScore Download
Model 1

-5.14 Download
Model 2

-5.07 Download
Model 3

-4.89 Download
Model 4

-4.82 Download
Model 5

-4.77 Download
Model 6

-4.69 Download
Model 7

-4.68 Download
Model 8

-4.66 Download
Model 9

-4.63 Download
Model 10

-4.63 Download

Download
Click Here to download all the results.


Note: Use ViewDock option in Chimera to display and analyze results on your local machine:
1) Open Chimera and click "Menu: File ... open" to open the receptor pdb file ("rec_clean.pdb");
2) Click "Menu: Tools ... Surface/Binding Analysis ... ViewDock" to open ViewDock and load the predicted peptide binding modes (e.g. "Top1k_models.pdb"). Once the file is successfully loaded, the program will ask for the file type. Choose "Dock 4, 5 or 6".

For questions or comments regarding this website, please Contact Us
Copyright 2021 - All Right Reserved