Results for job id J03118
Job information:
Job id: J03118
Job name: PTHR1_PTH134xiu
Job starting time: 2025-04-17/10:25:12
Job ending time: 2025-04-17/12:11:26
Peptide sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFGGRRRRRRRRR
Protein receptor structure: rec_clean.pdb
Top 10 predicted binding modes
Click the "View" button on the right panel to display the corresponding binding mode.
|
|
||||
| Models | Active | View | PepProScore | Download |
| Model 1 | -5.14 | Download | ||
| Model 2 | -5.07 | Download | ||
| Model 3 | -4.89 | Download | ||
| Model 4 | -4.82 | Download | ||
| Model 5 | -4.77 | Download | ||
| Model 6 | -4.69 | Download | ||
| Model 7 | -4.68 | Download | ||
| Model 8 | -4.66 | Download | ||
| Model 9 | -4.63 | Download | ||
| Model 10 | -4.63 | Download |
Download
Click Here to download all the results.
Note: Use ViewDock option in Chimera to display and analyze results on your local machine:
1) Open Chimera and click "Menu: File ... open" to open the receptor pdb file ("rec_clean.pdb");
2) Click "Menu: Tools ... Surface/Binding Analysis ... ViewDock" to open ViewDock and load the predicted peptide binding modes (e.g. "Top1k_models.pdb"). Once the file is successfully loaded, the program will ask for the file type. Choose "Dock 4, 5 or 6".