Art Figures

Results for job id J03634

Job information:
Job id: J03634
Job name: TIGR4
Job starting time: 2025-12-02/07:14:07
Job ending time: 2025-12-02/08:01:28
Peptide sequence: ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Protein receptor structure: rec_clean.pdb


Top 10 predicted binding modes
Click the "View" button on the right panel to display the corresponding binding mode.
Models Active View PepProScore Download
Model 1

-6.45 Download
Model 2

-6.41 Download
Model 3

-6.41 Download
Model 4

-6.3 Download
Model 5

-6.16 Download
Model 6

-6.13 Download
Model 7

-6.11 Download
Model 8

-6.05 Download
Model 9

-5.98 Download
Model 10

-5.88 Download

Download
Click Here to download all the results.


Note: Use ViewDock option in Chimera to display and analyze results on your local machine:
1) Open Chimera and click "Menu: File ... open" to open the receptor pdb file ("rec_clean.pdb");
2) Click "Menu: Tools ... Surface/Binding Analysis ... ViewDock" to open ViewDock and load the predicted peptide binding modes (e.g. "Top1k_models.pdb"). Once the file is successfully loaded, the program will ask for the file type. Choose "Dock 4, 5 or 6".

For questions or comments regarding this website, please Contact Us
Copyright 2021 - All Right Reserved