Results for job id J04031
Job information:
Job id: J04031
Job name: test1
Job starting time: 2026-05-02/22:15:30
Job ending time: 2026-05-03/01:34:39
Peptide sequence: HEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Protein receptor structure: rec_clean.pdb
Top 10 predicted binding modes
Click the "View" button on the right panel to display the corresponding binding mode.
|
|
||||
| Models | Active | View | PepProScore | Download |
| Model 1 | -6.28 | Download | ||
| Model 2 | -6.15 | Download | ||
| Model 3 | -6.1 | Download | ||
| Model 4 | -6.07 | Download | ||
| Model 5 | -6.07 | Download | ||
| Model 6 | -6.06 | Download | ||
| Model 7 | -5.97 | Download | ||
| Model 8 | -5.97 | Download | ||
| Model 9 | -5.95 | Download | ||
| Model 10 | -5.92 | Download |
Download
Click Here to download all the results.
Note: Use ViewDock option in Chimera to display and analyze results on your local machine:
1) Open Chimera and click "Menu: File ... open" to open the receptor pdb file ("rec_clean.pdb");
2) Click "Menu: Tools ... Surface/Binding Analysis ... ViewDock" to open ViewDock and load the predicted peptide binding modes (e.g. "Top1k_models.pdb"). Once the file is successfully loaded, the program will ask for the file type. Choose "Dock 4, 5 or 6".